PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_53373g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 390aa    MW: 44091.6 Da    PI: 5.745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_53373g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ll ++++ +G g+W++ ++  g+ R++k+c++rw +yl
    MA_53373g0010 14 RGPWTAREDLLLTKYIEAHGEGQWRALPKQAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding52.41.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T +E+el+v+++k+lG++ W++Ia +++ gRt++++k++w+++l
    MA_53373g0010  67 RGNITLDEEELIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNFWNTHL 112
                      7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.844961IPR017930Myb domain
SuperFamilySSF466891.8E-2811108IPR009057Homeodomain-like
SMARTSM007171.6E-121363IPR001005SANT/Myb domain
PfamPF002495.9E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-221568IPR009057Homeodomain-like
CDDcd001672.39E-91661No hitNo description
PROSITE profilePS5129425.74362116IPR017930Myb domain
SMARTSM007171.2E-1566114IPR001005SANT/Myb domain
PfamPF002492.2E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2569116IPR009057Homeodomain-like
CDDcd001672.73E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWTAR EDLLLTKYIE AHGEGQWRAL PKQAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TLDEEELIVR LHKLLGNRWS LIAGRLPGRT DNEIKNFWNT HLSKKLMMKG  120
IDPKTHQPAP ERIHKPRRLM KDNEDQETES FEHGMTEKDV ISSSGGKGVQ PIHLPKPNRY  180
IAFPRHLSHE ANVGITNTSV TNSDVQDVLL SPSIDLNSPC KNLQASVDSD HSSSGMLSDI  240
NPIHELGREV SNLPQQGDPE DCFPWACIED WPSEFQPTEP KCISNEVELE LQTSANNHII  300
PPPTKACRNN KPENCSNTLQ KIYEEYLKEF LQDETVPSNA EMVSSTTKNN GDDQEINIFP  360
EGLSSVWECL EGEDELLKDQ RASETLSLHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24121165108B-MYB
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1312240.0KU131224.1 Picea abies transcription factor MYB35 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.19e-71myb domain protein 5